PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37403.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family B3
Protein Properties Length: 353aa    MW: 40937.2 Da    PI: 6.8383
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37403.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B334.43.8e-1110603890
                EEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
          B3 38 ledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
                l ++ g++W+v+   +k+ g+++++kGWkeFv+   L++g  + Fk++g+s+ 
  KHN37403.1 10 LSSLYGNEWKVNW--TKQNGEVWFEKGWKEFVEHYSLDQGRLIFFKYEGTSQI 60
                556789*******..********************************997654 PP

2B3598.2e-19256347197
                 EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                 ff  +++ ++ k ++l++p +fa++hg++   ++t ++    +rsW vkl+y  k + + lt+GW+eF ++ +Lk+gD++ F+l+++ +f  v+ v+
  KHN37403.1 256 FFIREMHTSYIKYHILSIPIEFARNHGME---NITKVILRVGNRSWPVKLNYYSKHNYCRLTSGWSEFMSQCKLKSGDVCHFELIDKGKF--VFEVR 347
                 66677889999999************876...35566667799*******888888889*************************987777..54443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.744168IPR003340B3 DNA binding domain
SuperFamilySSF1019361.47E-12975IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-121078IPR015300DNA-binding pseudobarrel domain
PfamPF023622.0E-81059IPR003340B3 DNA binding domain
CDDcd100172.85E-71566No hitNo description
Gene3DG3DSA:2.40.330.101.5E-22250347IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-21251351IPR015300DNA-binding pseudobarrel domain
CDDcd100175.65E-19255347No hitNo description
PROSITE profilePS5086312.872256350IPR003340B3 DNA binding domain
PfamPF023624.8E-16256346IPR003340B3 DNA binding domain
SMARTSM010191.4E-10257350IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MEVACQIQCL SSLYGNEWKV NWTKQNGEVW FEKGWKEFVE HYSLDQGRLI FFKYEGTSQI  60
DILILDQSAL KIDYPCDTCD ENDNLDHTHE APDIIFGEWP YQKAGQMTEA YSLDLDHILV  120
FKYVGRSEFQ VVILDQSGLE MSYPLTEATL DGEDNGNSLP QSKRASSPLP FSPSTKKVKT  180
NTRKETNAYP IQDEDVETKC AQSKRNKAKK RGGRRIMYAN RRFSKSKAIQ NEELLQNTES  240
STALERANYF HSENPFFIRE MHTSYIKYHI LSIPIEFARN HGMENITKVI LRVGNRSWPV  300
KLNYYSKHNY CRLTSGWSEF MSQCKLKSGD VCHFELIDKG KFVFEVRVTG CID
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201209QSKRNKAKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618269.12e-61PREDICTED: uncharacterized protein LOC102661616
TrEMBLA0A0B2RYA10.0A0A0B2RYA1_GLYSO; B3 domain-containing transcription factor VRN1
STRINGGLYMA10G42774.15e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14649515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49475.13e-15B3 family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]